SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|119944110|ref|YP_941790.1| from Psychromonas ingrahamii 37

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|119944110|ref|YP_941790.1|
Domain Number 1 Region: 2-213
Classification Level Classification E-value
Superfamily CAC2185-like 1.06e-69
Family CAC2185-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|119944110|ref|YP_941790.1|
Sequence length 217
Comment exopolysaccharide biosynthesis protein-like protein [Psychromonas ingrahamii 37]
Sequence
MRIEIGRKVEKYIKSRLSRLKLKQNDFTIISNNCWGTFMYKKFALPYTTPFVNLLIFSPD
YIELLENLTPELLTKISFIEHENSQHKEEMVRLNIYKKNYPIGILDNKYELHFLHYQSQQ
DAKDKWLKRLARMNFDKLIVKFSASLKFEDNMAERFDDLNFKNKICFTATAFPNLKSIVS
MQAFKGKETVIDEWKHTTKKEFDLINFINNIQREDKA
Download sequence
Identical sequences A1SRS6
357804.Ping_0325 gi|119944110|ref|YP_941790.1| WP_011768750.1.40834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]