SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123965455|ref|YP_001010536.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965455|ref|YP_001010536.1|
Domain Number 1 Region: 50-230
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.87e-72
Family HD domain 0.00000214
Further Details:      
 
Domain Number 2 Region: 220-433
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.85e-60
Family RelA/SpoT domain 0.0000156
Further Details:      
 
Domain Number 3 Region: 416-489
Classification Level Classification E-value
Superfamily TGS-like 9.65e-19
Family G domain-linked domain 0.058
Further Details:      
 
Domain Number 4 Region: 693-765
Classification Level Classification E-value
Superfamily ACT-like 0.0000000142
Family Glycine cleavage system transcriptional repressor 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965455|ref|YP_001010536.1|
Sequence length 769
Comment guanosine-3',5'-bis(diphosphate) 3'-diphosphatase, (ppGpp)ase [Prochlorococcus marinus str. MIT 9515]
Sequence
MSEATADSKERKEIEVSTIIVPENKNYESESLKYEIKIPNWLLENIQNYELSNNKNDSNQ
DLIVKAFKLAYQAHNGQLRASGEPYIIHPIAVADLLKEIGASSSVIAAGLLHDVVEDTGI
ALSEIEINFGLEVKVLVEGVTKLGGIHFNNRTEAQAENLRKMFLAMASDIRVVLVKLADR
LHNMRTIQWLNEERKERIARETREIYAPLANRLGINRFKWELEDLAFKFLEPDEYKNLKD
QIVVKRSDREKRLDNTLNLMKENLVSSGLKNFEITGRPKHLYGIWSKMERQQKQFSEIYD
VAALRIIVSNLDSCYKALAVVHDTFRPIPGRFKDYIGLPKPNGYQSLHTSVIGKHRPIEV
QIRTTSMHQIAEFGIAAHWQYKEGGSPASSNAERFNWLRQLVEWQQEGNEKDHNDYLASI
KEDLFDEEVFVITPKGDVVGLRKGSTAIDFAYRIHSEIGNHCNGIRINEKLSPLSTSLQN
GDFIEILTNNNSTPSLDWLNFVVTPTAKNRIRQWYKKSHRDETIKRGKDLLEKEIGRNGF
ESLLSSDAMQKVAHRCNLKTTEDLLASLGFGGLTLHQVLNRLREEIKIQTEEIKNESNAE
IAKTLVNKNNSITTKSHATNKSPISGVEGLDYRIGKCCSPLPGEEIIGTVSLGNHGITIH
RRDCENVLPIPIERRLPVAWNQENKVLDNKFPIQLRIEVIDRVGVLKDILMRLSDKGINV
SDANVKTAFGKPAIINLCVGLESYSQLHKTIDQIKSMADVLDIARVGIS
Download sequence
Identical sequences A2BUG8
WP_011819543.1.83733 167542.P9515_02201 gi|123965455|ref|YP_001010536.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]