SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123965590|ref|YP_001010671.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965590|ref|YP_001010671.1|
Domain Number 1 Region: 2-401
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.9e-89
Family HD domain 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965590|ref|YP_001010671.1|
Sequence length 419
Comment HD superfamily phosphohydrolase [Prochlorococcus marinus str. MIT 9515]
Sequence
MNKKRIFHDPIHKEIIIDSDKPEELMIMQLIDTLAFQRLRRIKQLGAASLLFHGAESSRF
THSIGVFCVARKIYRRLLETKPEFSKSKFILFGAALLHDLGHGPLSHTSEVIFPHNHEYW
SKNLVENYSPITSILKNFGDELPKQIGDLFTTQNLFSNPLKTLISSEIDCDRLDYLLRDS
YNTGTKYGLVDLERIISALTFSPDGNIAIKPKGVIAIEHFLVLRNIMYRTIYNHRINEIS
TWILEKIIYSIKNNSRKKSIWIDEIMYKWIFTPKDLEIREFLANDDIVFYFHLMKWKDKS
FEPLETLCKMFIDRNLLKASNISFLSKLKRMEVLAFARKKCKLNNYDSEIFCGIKERSFK
GFESNNSLKIWDGTYQNLLENHSALIKTLMTSNNSSLIIYPGEFRREIENQIAILRDDP
Download sequence
Identical sequences A2BUV3
gi|123965590|ref|YP_001010671.1| 167542.P9515_03551 WP_011819672.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]