SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123965595|ref|YP_001010676.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965595|ref|YP_001010676.1|
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 5.63e-35
Family N-terminal domain of MutM-like DNA repair proteins 0.00066
Further Details:      
 
Domain Number 2 Region: 153-242
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.36e-27
Family Middle domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 3 Region: 242-293
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000152
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965595|ref|YP_001010676.1|
Sequence length 293
Comment formamidopyrimidine-DNA glycosylase [Prochlorococcus marinus str. MIT 9515]
Sequence
MPELPEVETVRKGLEQKLKNFIIKRVEICRESTVAYPIDKQDFVKGLQNSLINKWDRRGK
YLIAKLKKADRNHTYIENEMSLKNNGSLVVHLRMTGYFTFNKNPTSPCKHTRIRLFDNNN
NELRYIDVRSFGQMWWVREGLSPKNIIKGLGALGPEPFSEKFNISYLTKIILNKTRSIKS
ILLDQTIVAGIGNIYADESLYSAGISPFREARTIEKHELIKLRIAIIEVLKKSIGAGGTT
FSDFRDLEGENGNFGLQTNVYRRTGKKCHACKNLIERQKISGRSTHWCRKCQK
Download sequence
Identical sequences A2BUV8
WP_011819677.1.83733 167542.P9515_03601 gi|123965595|ref|YP_001010676.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]