SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123965755|ref|YP_001010836.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965755|ref|YP_001010836.1|
Domain Number 1 Region: 337-530
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.63e-44
Family Ppx associated domain 0.0016
Further Details:      
 
Domain Number 2 Region: 142-324
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.24e-41
Family Ppx/GppA phosphatase 0.0017
Further Details:      
 
Domain Number 3 Region: 16-137
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.78e-33
Family Ppx/GppA phosphatase 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123965755|ref|YP_001010836.1|
Sequence length 531
Comment exopolyphosphatase [Prochlorococcus marinus str. MIT 9515]
Sequence
MIQENELSNLQEKNILVASIDIGTNSTHLLISEVNLDLKSFSIKFTDKSTTRLGEKDEEG
NLTEESIQRVLYTLKRFKEYCNSNGVNQIVTAATSAVREAPNGRDFLNRVQKELGIQIEL
ISGSEEARLIYLGVLSGMAFEDESYVIIDIGGGSTELILADKKDAIALTSSRVGAVRLKN
DFLNEEPISNERSKFLKTFIRGSLEPSVEKIKRRLHKEKSVAMIATSGTAISLGNLILSD
LSQPKQKMHGYKFKKDNLEVILEKLIKMPITEIKKIPSLSERRAEIIIPGALILNTSMDM
LDFNELTISERALREGLVVDWMLRQGIIKNEFNIQSNIRKTTIVHQARKFGVDKNRSEKV
TNIAFQIYDQTKNIFHSDTDSKAKKLLWAACHLYSCGKYVNINSYHKHSWYLIKHCELLG
YSQLETNIIASIARYHRKTLPKKRHESWQSLISKEEKTIVLEMSLILRLAASLDQRPENV
ISSIKIKLQKNALSMEIIPFNSNQDLLLEKWSLESCRNAIKELKNLELKVV
Download sequence
Identical sequences A2BVB8
167542.P9515_05201 WP_011819837.1.83733 gi|123965755|ref|YP_001010836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]