SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966020|ref|YP_001011101.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966020|ref|YP_001011101.1|
Domain Number 1 Region: 1-238
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.91e-72
Family Histidine biosynthesis enzymes 0.000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966020|ref|YP_001011101.1|
Sequence length 255
Comment 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase [Prochlorococcus marinus str. MIT 9515]
Sequence
MKLIPAIDLMNGKCVRLFKGDFNKRKDFSRKPYEQAKYWEEQGAKCIHIVDLDAAKSGYP
SNDQSIKKIAKEVNIPIQIGGGIRSLERIEQLFSYGVDKVIMGTSAIENKELVKNLSTKF
PRRIIIGIDAKDGKVSTRGWIEQSDVLATDLVKEFSKFEIASFIVTDINTDGTLEGTNEV
FIKKILEITDIPVIASGGVGAISDLLSLTKFEHLGLCGVIVGKALYENKFKISEANNILS
PERLQDIPINKDYFA
Download sequence
Identical sequences A2BW33
167542.P9515_07851 gi|123966020|ref|YP_001011101.1| WP_011820099.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]