SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966185|ref|YP_001011266.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966185|ref|YP_001011266.1|
Domain Number 1 Region: 217-406
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.91e-52
Family B3/B4 domain of PheRS, PheT 0.0000632
Further Details:      
 
Domain Number 2 Region: 43-200
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.26e-37
Family Myf domain 0.0038
Further Details:      
 
Domain Number 3 Region: 498-706
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.44e-35
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0002
Further Details:      
 
Domain Number 4 Region: 722-820
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 7.06e-25
Family Anticodon-binding domain of PheRS 0.0045
Further Details:      
 
Domain Number 5 Region: 441-505
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000128
Family Domains B1 and B5 of PheRS-beta, PheT 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966185|ref|YP_001011266.1|
Sequence length 820
Comment phenylalanyl-tRNA synthetase subunit beta [Prochlorococcus marinus str. MIT 9515]
Sequence
MKVSQNWLKSLVDINTSPEDLSEKLSIGGFEVESLINCSENVKGVVLGKVISVVKHDNSD
KLSICNVDIGSSNSLQIVCGAKNVKANIYVYVATVGVHLNAINLTIKKSEIRGTLSEGMI
CSLEELGIEDNSEGIAIIEEEKASKHILGTPAALLLDLNDYVYDLAITANRPDGMSVVGI
AREISALLETNLNLPKIKNVYEINVHKDFDLCTEAITKKCLYSISKIVSVSGKKITPQWI
KDRLDKSGINSINLLVDITNFILLEQGQPLHAFDFDKLTNLVGREVLPEDFSVRKAKENE
SLLCLNGEIYKLNENITIIACDDKPVAIAGVIGGLQTAVDKETSSIYLEGAVFNPVTIRK
SVKEIGVRTESSSRYEKGISFKNTLNSVSRAINIIEEYFNITKPVIHTSIDLPNTEILIP
LRRNRIHKLLGPLAIRNNDYEMNGQIQKRNLSDKEITDKLKLIGCKLNNKEYGWDVEVIP
NRSQDLVREIDLIEEIARLIGYDMFDFNLPNPIKPGKLSSSQIALRKLKTGFIDNGFNEV
LSYSLVPETNNDLIKISNPLLTETSCLRDNIWQEHIKICNQNINSGYDYCWIFEVGNIFH
KKPDISQEEILNGAIYGNNKFDKWYRSSKDENLNYYEARGKLKEALTLLNISIEDKPTDS
IDFLHPGRTAKLFTEGKEVGYFGEIHPKLVSNKKALKKMYLFSLKIPNILNACTRKNKWI
PVYKQFPTVPKMERDINFIFNKKYLVNEIVSQIKKSGKKLLEEVNLIDVYDDNSFGNDFI
SYTFRLSYRDSEKTLLDSDIVDLHENIVEIIEKKFSTKLR
Download sequence
Identical sequences A2BWJ8
167542.P9515_09521 WP_011820261.1.83733 gi|123966185|ref|YP_001011266.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]