SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966302|ref|YP_001011383.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966302|ref|YP_001011383.1|
Domain Number 1 Region: 7-197,351-385
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000138
Family FAD/NAD-linked reductases, N-terminal and central domains 0.077
Further Details:      
 
Weak hits

Sequence:  gi|123966302|ref|YP_001011383.1|
Domain Number - Region: 198-231
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0523
Family HLH, helix-loop-helix DNA-binding domain 0.014
Further Details:      
 
Domain Number - Region: 220-256
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.0968
Family Probable GTPase Der, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966302|ref|YP_001011383.1|
Sequence length 386
Comment hypothetical protein P9515_10691 [Prochlorococcus marinus str. MIT 9515]
Sequence
MQNQQLYDIAIIGGGISSSVFTSSHIKNGFSGKLAIIENGRNLGGRSSTRYSQINNGWEL
NHGSPNLNICNKKNNQLLKTFIQELLDEEIIQQDTSEFIELNEDYIPSKIDSDFHSGTNY
IPRTSMSELAKNIISYNNLRNQVDYFFETLIFKLDFKDNRWILTSKNGYEINSKFLICSS
NLILHKRSLDIMKISQTPLRKAIPIYKDKKLDKIINLLNQQNYIKRLTFMIYTNSYYDYK
DDYKKKYRYFILNNVFEEKYKFERIIFQRQKNNKLGIVIHTRNNEFINEYFQNKNIKLFK
KNLLLKFNQIFQNQPHINKIIDYQDISIMKWRASQPSGIGIPENLQVCESHNIAFCGDWI
GNEGFGRMEGAILSALNLSHKINKLF
Download sequence
Identical sequences A2BWW5
167542.P9515_10691 gi|123966302|ref|YP_001011383.1| WP_011820376.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]