SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966391|ref|YP_001011472.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966391|ref|YP_001011472.1|
Domain Number 1 Region: 276-420
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000942
Family HD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966391|ref|YP_001011472.1|
Sequence length 490
Comment HD superfamily hydrolase [Prochlorococcus marinus str. MIT 9515]
Sequence
MHNLKTTLKKIIYYWKRSQVPTKEPSKISTIDKLIIFLICIVISIISSYKILLAPFLQSS
VVLSWGLTFLEVLVSCGFLIIISRKENPTINSRQILLIISLLLIVQAIKTLFVYRISPLS
IIVPPSLIISQGMGTITALAWVSIASLSWPDSVIEINSNLLLITLICACIVSVLGGKIRS
RAQLLQLSIFVPLGALIAQWLFIGNDKTSLVDNQEFFVSNGQIFSDSFLLAIIMLITILF
IPIFESIFGLLTKARLLELADKEKPLIRRLSIEAPGTFEHTLLICGLAEEATRMIGGDID
LIKTGSLYHDVGKLHAPNWFIENQDGSKNPHDELDDPLKSAEVLQAHVDEGLKFARKNRL
PKPIANFIPEHQGTLKMGYFLHKAEEKKLNIKESDFRYKGPIPQSKETAILMLADGCEAA
LRAMDIKASDHKALETISKIVNSRQIDGQLVDSNLSKGEIFLIKKSFLNVWKRIRHRRIQ
YPTTKNNTFS
Download sequence
Identical sequences A2BX54
167542.P9515_11581 WP_011820465.1.83733 gi|123966391|ref|YP_001011472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]