SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966407|ref|YP_001011488.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966407|ref|YP_001011488.1|
Domain Number 1 Region: 9-358
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.73e-64
Family GABA-aminotransferase-like 0.035
Further Details:      
 
Domain Number 2 Region: 328-449
Classification Level Classification E-value
Superfamily Ornithine decarboxylase C-terminal domain 8.89e-24
Family Ornithine decarboxylase C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966407|ref|YP_001011488.1|
Sequence length 465
Comment Orn/Lys/Arg decarboxylase family protein [Prochlorococcus marinus str. MIT 9515]
Sequence
MSISSFLTKKFLKSLFFPAHNRGKALPKGLIRLLKKEPGFWDLPELPEIGSPLSKSGLIH
DAQISISKKLNTKKCFFGVNGASGLIQSGIITMANPGEYILMPRNVHISVIKACALQNII
PIFFDIEFSIETGHFMPITKKWFMNVFNNIDLEKRKIAGVILVNPYYQGYASNIEPLIKI
CHQHNLPVLVDEAHGSYFLFCENLGLPKSAIRSKADLVVHSLHKSLNGLTQTAVIWHNGN
LIEENNLIKSINLLQTTSPNSLLLSSCEESIKDWLNKDNLDKYKKRISEAKKIFKELKKR
KIPLIETQDPLKIVLNTSEVGIDGFTADRFFYKNGLIAELPEMKTLTFCLGFSNQKDFIS
LFQDLWEKLLIQTNKSYSLKAIKPPFRLVQSPEVPIGVAWRSKTYSIPLAESLGKISADI
ICPYPPGIPLIVPGERIDKERIDWIETQSLYNQDLLNSYIRVLHN
Download sequence
Identical sequences A2BX70
gi|123966407|ref|YP_001011488.1| WP_011820481.1.83733 167542.P9515_11741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]