SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966692|ref|YP_001011773.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966692|ref|YP_001011773.1|
Domain Number 1 Region: 3-348
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.71e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00089
Further Details:      
 
Domain Number 2 Region: 355-474
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 7.39e-35
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966692|ref|YP_001011773.1|
Sequence length 479
Comment dihydrolipoamide dehydrogenase [Prochlorococcus marinus str. MIT 9515]
Sequence
MTDLNFDFDLIVIGAGYGGFDAAKHAAGKGLKVAIVESGDMGGTCVNKGCVPSKALLAAS
GKVREIANYEHLSRFGIHASPVRFERSKIADHANNLVSNVRENLTKTLKRSGVEIILGFG
RLEGNQKVGVRDKNGIDKIFTCKNTVIASGSSPFVPPGINLDNRTVFTSDEAVKLEWLPR
WIAIIGSGYIGLEFADVYTALGCEVTMIEALENIMPTFDPDITKIAKKNLIQSRDIDTKS
NVFATKITPGCPVKIELTDAKSKEIVENLEVDAVLVATGRSPNSKNLNLDSVGIETVKGY
IPIDDQMRVINGKKIIPNVWAVGDVTGKLMLAHTAAAQGTIAVDNICGKNIEINYGSIPA
ATFTHPEISSVGLSETDAKEKAIKEDFTLGVVKSYFKANSKALAELESDGILKLLFNKDS
GKVLGAHIFGMHAADLIQEIANAISRNQDVIQLASEVHTHPTLSEVVEVAYKQAASQVK
Download sequence
Identical sequences A2BY05
gi|123966692|ref|YP_001011773.1| 167542.P9515_14591 WP_011820763.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]