SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966695|ref|YP_001011776.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966695|ref|YP_001011776.1|
Domain Number 1 Region: 24-415
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.49e-114
Family GABA-aminotransferase-like 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966695|ref|YP_001011776.1|
Sequence length 417
Comment acetylornithine aminotransferase [Prochlorococcus marinus str. MIT 9515]
Sequence
MELVDAPHSKCGTFGFVGSSPTAPTLMNTYTRFNISFKKGEGCWLWDTRGKKYLDAVAGI
ATCSLGHSDRILRKKLVAQLKKLQHISNLYKIEEQEELSKYLTKQSCAESVFFCNSGAEA
NESAIKLIKKFGNKIYTGKETFILAAESSFHGRTLATLSATGQPKYQKGFEPMVKGFKFF
KYNDIASVKKLFDECQKNDQKVSGVLIEPIQGEGGVIPGDKLFFKDLRKLCTQNNSLLIL
DEVQSGVGRTGKMWGYETLGIEPDGFTLAKGLGGGHAIGALLVKEKANIFSPGDHASTFG
GNPFACRAALTVLEEITRRKILNNVISRGNQLNEGFIKLSDKFPNIINGIRGIGLIQGLV
INNSYTDPKTITLKAFDKGLLLVPAGGNVVRFVPPLIISRNEIKILLKKLNLIFEEL
Download sequence
Identical sequences A2BY08
gi|123966695|ref|YP_001011776.1| 167542.P9515_14621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]