SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966726|ref|YP_001011807.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966726|ref|YP_001011807.1|
Domain Number 1 Region: 171-489
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.85e-109
Family Leucine aminopeptidase, C-terminal domain 0.00000043
Further Details:      
 
Domain Number 2 Region: 1-174
Classification Level Classification E-value
Superfamily Macro domain-like 2.3e-23
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966726|ref|YP_001011807.1|
Sequence length 495
Comment leucyl aminopeptidase [Prochlorococcus marinus str. MIT 9515]
Sequence
MQFSNFQQDLNTWQGSILIFGIVEEDLKSQLEKISCIIDSKLLLEKINQKKFIGEKGKIL
NFDFFDQKLQSLKIIGLGKGKNININDIKNLLADVIRKNDDKDEKVSIMFPWNLINSPEE
IRSLGESARLSAYKDNRFNSKKDDKKVLKEIEFLNLNKFENINFNETEYICEGVELARRL
VAAPPNSLTPLEMSRQASIIAKEHGLEIKILDRKECEDLGMGAYLAVAKGSDLEPKFIHL
TLKSKSPIKEKIALVGKGLTFDSGGYNLKVGASQIEMMKYDMGGSASVLGAAKALGAIKP
DGLEIHFIVAACENMINGSAVHPGDVIKASNGKTIEINNTDAEGRLTLADALTYASNLKP
DSIIDLATLTGAIVVALGNDVAGFWTNNHLMAEDLKIASSQAGEALWQMPLQKSYKDGLK
SHIADMKNTGPRAGGSITAALFLEEFFDNKIKWAHIDIAGTCWTDKSKGINPLGATGFGV
KTLVQWIKNKRQDNK
Download sequence
Identical sequences A2BY39
gi|123966726|ref|YP_001011807.1| WP_011820796.1.83733 167542.P9515_14931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]