SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966747|ref|YP_001011828.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966747|ref|YP_001011828.1|
Domain Number 1 Region: 44-297
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.09e-35
Family Ribosomal protein L11 methyltransferase PrmA 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966747|ref|YP_001011828.1|
Sequence length 300
Comment methyltransferase for ribosomal protein L11 [Prochlorococcus marinus str. MIT 9515]
Sequence
MEINYWYKLTFEIEANLEEIIIWKLNELGISSYALEILLNNKNNKKVLIWLPNLNWPKSL
RIKLERNIKEVLDKNNYRTNCFEWIVIEQEDWMSSWKKYWGPELVGKKLLVLPCWLELPE
KFKNKKVIKIDPGAAFGTGSHPTTSLCLEELEKFSLSNKKILDIGSGSGILSIAARYFGA
SKVYSIDNDYLAINSTESNFRLNFGDLDDLKTYLGRFDELVSKYSLKNFDLILCNILAEV
IKGIIPDIRNCLKINGEVIFSGILNSQKDEIIKLLNASNLQINDVSSKQGWVCITAQKII
Download sequence
Identical sequences A2BY60
167542.P9515_15141 WP_011820817.1.83733 gi|123966747|ref|YP_001011828.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]