SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966931|ref|YP_001012012.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966931|ref|YP_001012012.1|
Domain Number 1 Region: 118-244
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.92e-30
Family NlpC/P60 0.0000229
Further Details:      
 
Domain Number 2 Region: 19-90
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 0.00000000000000623
Family Spr N-terminal domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966931|ref|YP_001012012.1|
Sequence length 251
Comment hypothetical protein P9515_16981 [Prochlorococcus marinus str. MIT 9515]
Sequence
MKKNIDPISLFKQTNFSNTIWWEVKINISGYQNETENNLVTEIFKNRIFKLIYPTPYQSK
KRLSRILVQFYEDGYICWIDLDKLIIEKFNFNNSFIKSDEIFIREKIPLVLNWIKNQSKL
KNQYLWGGTIGPNFDCSGLIQTAFLNYGIYIPRDSYQIKSFCRHLFNFTEIKYSLEKGDI
LFFGNSKKCDHVGIYKGEGLYYHCSGNDFGRNGIGIDTLKKTNDRISLHYQSKLISAGRI
FRSFRWDKTIR
Download sequence
Identical sequences A2BYP4
WP_011820997.1.83733 gi|123966931|ref|YP_001012012.1| 167542.P9515_16981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]