SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966967|ref|YP_001012048.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966967|ref|YP_001012048.1|
Domain Number 1 Region: 112-209
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 3.01e-37
Family Ribosomal protein S3 C-terminal domain 0.0000191
Further Details:      
 
Domain Number 2 Region: 2-109
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 2.07e-32
Family Prokaryotic type KH domain (KH-domain type II) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966967|ref|YP_001012048.1|
Sequence length 244
Comment 30S ribosomal protein S3 [Prochlorococcus marinus str. MIT 9515]
Sequence
MGNKINPTGLRLGITQEHRSKWFATSKTYPILLQEDYKIRNFIQKKYSSAGISDVLIARK
ADQLELELKTARPGVIVGRQGSGIEELRSGIQKTIGDRTRQVRINVVEVERVDADAYLLA
EYIAQQLEKRVAFRRTIRMALQRAQRAGVLGLKIQVGGRLNGAEIARSEWTREGRVPLHT
LRAEVDYALREANTTYGVLGIKVWVFKGEVLPKEEQTIPVGAIPRRKGSRKPQQFEDRSS
NENS
Download sequence
Identical sequences A2BYT0
WP_011821031.1.83733 gi|123966967|ref|YP_001012048.1| 167542.P9515_17341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]