SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123967028|ref|YP_001012109.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123967028|ref|YP_001012109.1|
Domain Number 1 Region: 7-65
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000117
Family 7-Fe ferredoxin 0.0000861
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123967028|ref|YP_001012109.1|
Sequence length 81
Comment photosystem I subunit VII [Prochlorococcus marinus str. MIT 9515]
Sequence
MSHAVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGDETSRSMGLAY
Download sequence
Identical sequences A0A081GIE8 A0A089P8H6 A0A0A1ZUI0 A0A0A2B6A0 A0A0H4BAZ0 A0A1Q1EW04 A0A2D7TKV7 A0A2E0AGL4 A0A2E1IHW4 A2BTI9 A2BYZ1 A3PF98 A3Z491 A8G7B3 K9P859 Q05UG0 Q7UZQ1
gi|427703414|ref|YP_007046636.1| gi|157414214|ref|YP_001485080.1| gi|123969349|ref|YP_001010207.1| gi|33862163|ref|NP_893724.1| gi|126697138|ref|YP_001092024.1| gi|123967028|ref|YP_001012109.1| WP_007099573.1.100652 WP_007099573.1.1692 WP_007099573.1.19047 WP_007099573.1.19096 WP_007099573.1.26171 WP_007099573.1.27332 WP_007099573.1.28265 WP_007099573.1.29415 WP_007099573.1.2955 WP_007099573.1.30112 WP_007099573.1.36019 WP_007099573.1.39572 WP_007099573.1.42548 WP_007099573.1.43709 WP_007099573.1.44738 WP_007099573.1.49409 WP_007099573.1.50075 WP_007099573.1.52979 WP_007099573.1.56588 WP_007099573.1.60321 WP_007099573.1.61476 WP_007099573.1.6215 WP_007099573.1.63644 WP_007099573.1.67920 WP_007099573.1.74750 WP_007099573.1.74777 WP_007099573.1.75422 WP_007099573.1.77012 WP_007099573.1.786 WP_007099573.1.79548 WP_007099573.1.81093 WP_007099573.1.83733 WP_007099573.1.87571 WP_007099573.1.89092 WP_007099573.1.89331 WP_007099573.1.93620 WP_007099573.1.93824 WP_007099573.1.93959 WP_007099573.1.95287 WP_007099573.1.95473 146891.A9601_18171 167542.P9515_17951 167546.P9301_18001 59919.PMM1607 93060.P9215_18811 MES00000668294 2014628622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]