SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966217|ref|YP_001011298.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966217|ref|YP_001011298.1|
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 1.59e-24
Family Ribosomal protein L28 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966217|ref|YP_001011298.1|
Sequence length 78
Comment 50S ribosomal protein L28 [Prochlorococcus marinus str. MIT 9515]
Sequence
MSRVCELTGARANNGMAVSHSHIRTKKLQQVNLQKRRLWWQEGKKWINIKISTKALKSIQ
KVGLDKVAKTNGVDLNKF
Download sequence
Identical sequences A2BWN0
WP_011820293.1.83733 gi|123966217|ref|YP_001011298.1| 167542.P9515_09841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]