SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147668693|ref|YP_001213511.1| from Dehalococcoides sp. BAV1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147668693|ref|YP_001213511.1|
Domain Number 1 Region: 7-94
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00000188
Family Di-heme elbow motif 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147668693|ref|YP_001213511.1|
Sequence length 148
Comment C_GCAxxG_C_C family protein [Dehalococcoides sp. BAV1]
Sequence
MSDIAVSAQILHEKGFNCAQSLLAAFAPSLGIETGTALKLASAFGGGMAARGDTCGVISG
GLMVIGLKFGQASVEDKAAREKCNRLGREFLKQFEAEFGATACRDLIKCNIGTPEGAKMV
KEKGLREGLCSKLVYRGAEILSALIEQI
Download sequence
Identical sequences gi|147668693|ref|YP_001213511.1| 216389.DehaBAV1_0041 WP_011928572.1.45256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]