SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147669040|ref|YP_001213858.1| from Dehalococcoides sp. BAV1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|147669040|ref|YP_001213858.1|
Domain Number - Region: 29-109
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0502
Family Di-heme elbow motif 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|147669040|ref|YP_001213858.1|
Sequence length 116
Comment hypothetical protein DehaBAV1_0395 [Dehalococcoides sp. BAV1]
Sequence
MGVCVHKLRWKQSNLYQGGAVMAQDKTLVCRDCGNEFIFTAGEQEFYASRGLKNEPKRCP
TCRSARRSENRAEGGERRTYEVVCAACGVQTTVPFEPTEGRPVYCKDCYAKTKESE
Download sequence
Identical sequences 216389.DehaBAV1_0395 gi|147669040|ref|YP_001213858.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]