SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147669328|ref|YP_001214146.1| from Dehalococcoides sp. BAV1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|147669328|ref|YP_001214146.1|
Domain Number - Region: 20-120
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000251
Family Di-heme elbow motif 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147669328|ref|YP_001214146.1|
Sequence length 122
Comment hypothetical protein DehaBAV1_0684 [Dehalococcoides sp. BAV1]
Sequence
MIVLFGNKSYFDILGYMVTTCPGCKTTSVMTVEQQRKKLTVYFIPTFDFSRKQYMYCGHC
HERFEIDKSLQSTVKARLLSKKQMEKLMVELEMEKPRYECANCESRIEAGMKFCPQCGNN
LG
Download sequence
Identical sequences WP_011929018.1.45256 216389.DehaBAV1_0684 gi|147669328|ref|YP_001214146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]