SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|147669748|ref|YP_001214566.1| from Dehalococcoides sp. BAV1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|147669748|ref|YP_001214566.1|
Domain Number - Region: 7-23,74-100
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00561
Family Di-heme elbow motif 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147669748|ref|YP_001214566.1|
Sequence length 106
Comment hypothetical protein DehaBAV1_1108 [Dehalococcoides sp. BAV1]
Sequence
MAYQDKEIQCADCGASFTFTGSEQELYASRGYTNDPKRCVSCRQARKAERGGSTGGFGGG
MSRGPARQMFQAVCAQCGQDTEVPFEPRQGRPVYCSNCYNRVKGGR
Download sequence
Identical sequences A0A142VAU4
gi|452203965|ref|YP_007484098.1| gi|452205464|ref|YP_007485593.1| gi|73748981|ref|YP_308220.1| gi|289432977|ref|YP_003462850.1| 216389.DehaBAV1_1108 255470.cbdb_B26 WP_011309655.1.17753 WP_011309655.1.45256 WP_011309655.1.48192 WP_011309655.1.52557 WP_011309655.1.55841 WP_011309655.1.5855 WP_011309655.1.62194 WP_011309655.1.66924 WP_011309655.1.67918 WP_011309655.1.74482 WP_011309655.1.75083 WP_011309655.1.79047 WP_011309655.1.83924 WP_011309655.1.84634 WP_011309655.1.89941 WP_011309655.1.91135 WP_011309655.1.92458 gi|147669748|ref|YP_001214566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]