SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116753467|ref|YP_842585.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116753467|ref|YP_842585.1|
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 4.58e-37
Family CbiG N-terminal domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 139-253
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 2.09e-23
Family CobE/GbiG C-terminal domain-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116753467|ref|YP_842585.1|
Sequence length 254
Comment cobalamin biosynthesis protein CbiG [Methanosaeta thermophila PT]
Sequence
MEELFREYDMILALMAVGIVVRQVCPLLRDKWTDKPVVAVDSALKTAVPVIGGHHGANDL
ALYLFKHLGIYPAITTATDSSGRPNLEGIASAFGSEIVNRDASKHINASFLYQDVPIVRL
RGPRIVIVDKDVAVLKSSGLIAGLGARKGATADEILSAVRSATAEAGRDVSEVRVIATSE
IKSCDPEISRAAAKLGVSVVYLPDDALNAQKPLTPSRASMLGLSGVAEPAVLALAQRMIL
PKKVYGRVTVALGE
Download sequence
Identical sequences A0B5H1
349307.Mthe_0145 gi|116753467|ref|YP_842585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]