SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116753882|ref|YP_843000.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116753882|ref|YP_843000.1|
Domain Number 1 Region: 6-277
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.67e-143
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000703
Further Details:      
 
Domain Number 2 Region: 278-558
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 1.73e-140
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.00000000279
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116753882|ref|YP_843000.1|
Sequence length 559
Comment coenzyme-B sulfoethylthiotransferase [Methanosaeta thermophila PT]
Sequence
MAKLHTKKLFVRALTKKFGKDFDLSSQKTEYKRLGPEQSARKREFMEYSKKLEGKRGISF
YNPYLHCGGVPLGQRQLVPYKLSNTEYIVEGDDLHFVNNPAMQQMWDDIRRTVVVGLDMA
HEVLEKRLGKEVTPETINNYLEILNHAMPGAAVVQEHMVETHPGLVEDCNVRVFTGDDDL
ADEIDPQYLIDINKLFPADQAEQLKAAIGKTTWQAIHIPTIVVRSCDGGTTSRWSAMQLS
MTFIDAYNMCAGEAAVADLAYAAKHAAVLQMSDMLPARRARGPNNPGGLSFGFMADMVQT
SRVKPWDPTQVSLNVVAAGTMLYDQIWLGSYMSGGVGFTQYATAAYTNDVLDDFSYYGVD
YAVEKYGGFAKAPANLEVVKDLATEVTLYALEQYESFPTLLEDHFGGSQRAGVTAAASGI
TCAIATGNSQAGLAGWYLSQLLHKEAHGRLGFFGYDLQDQCGPTNVFSYQSDEGNPLELR
GANYPNYAMNVGHQGEYAGISSAAHAGRGDAFACNPLIKVTFANPALVFDWTDIRLCFGK
GGAREFRAAGERSLVMPAV
Download sequence
Identical sequences A0B6N6
349307.Mthe_0569 gi|116753882|ref|YP_843000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]