SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116754444|ref|YP_843562.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116754444|ref|YP_843562.1|
Domain Number 1 Region: 3-242
Classification Level Classification E-value
Superfamily Aquaporin-like 9.55e-58
Family Aquaporin-like 0.0000399
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116754444|ref|YP_843562.1|
Sequence length 245
Comment MIP family channel protein [Methanosaeta thermophila PT]
Sequence
MSLAKRCLAEVVGTAILVYFGAGAAAITLMISKGSSPPNPFNIGIGALGGLGDWFAIGMA
FAIAIAGVIYALGRVSGAHINPAVTIALWATRRFPSGEVIPYIVAQLIGASLGSLLFAAS
AGSDAVMVGGLGATAPFPGISFGQAVLAEAIGTFLLMLVIMGVAVDERAPQGFAGLIIGL
TVGGVITTTGNIAGSSLNPARTFGPYLVDHIMGGPVLWSHYPIYVIGPVLGALVAAFLYD
ILAKE
Download sequence
Identical sequences A0B898
349307.Mthe_1139 gi|116754444|ref|YP_843562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]