SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116754883|ref|YP_844001.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116754883|ref|YP_844001.1|
Domain Number 1 Region: 55-343
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 8.24e-49
Family TM0189-like 0.084
Further Details:      
 
Weak hits

Sequence:  gi|116754883|ref|YP_844001.1|
Domain Number - Region: 2-47
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0186
Family Type I dockerin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116754883|ref|YP_844001.1|
Sequence length 377
Comment periplasmic binding protein [Methanosaeta thermophila PT]
Sequence
MDDKIDEMDVAYVQGIIDGKMEPTMLSDANCDGKIDFEDIDQINALIKDEAKFLIVVDSV
GRNVTIKLPINKLIALGSYRIEAVKILNAENKVVGISSDIPDKNYYYPELIEKPLVGTWS
SPDSETIVALSPDIVITSANLQRATNLENALKYANIPVIGLDFYRDDIIKSEIRTLGFIL
NKDDEAERYIKWRRGYEQTITDYVAKLEDNDKPHVFMEWGTKNTASEISSYGRGSSGDAV
CRFTGGINIAADLPEYPKVDSEWVLATNPDIIIRMLAPGGEKPGWNNTEETASILKNYIE
SRPGWTNLEAVKNNRVHLLSTEIAWGPDSIVGVAYFAKWLHPSIDIDPMKIYMEYLEDFM
DLRYSEEDIGVLGYPTK
Download sequence
Identical sequences A0B9I7
349307.Mthe_1591 gi|116754883|ref|YP_844001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]