SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116754978|ref|YP_844096.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116754978|ref|YP_844096.1|
Domain Number 1 Region: 1349-1426
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 2.35e-16
Family Hypothetical protein PA1324 0.0096
Further Details:      
 
Domain Number 2 Region: 559-826
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000879
Family I set domains 0.088
Further Details:      
 
Weak hits

Sequence:  gi|116754978|ref|YP_844096.1|
Domain Number - Region: 989-1058
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000122
Family C1 set domains (antibody constant domain-like) 0.05
Further Details:      
 
Domain Number - Region: 491-560
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000125
Family C1 set domains (antibody constant domain-like) 0.05
Further Details:      
 
Domain Number - Region: 408-477
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000127
Family C1 set domains (antibody constant domain-like) 0.05
Further Details:      
 
Domain Number - Region: 350-411
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000153
Family I set domains 0.089
Further Details:      
 
Domain Number - Region: 906-975
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000164
Family C1 set domains (antibody constant domain-like) 0.069
Further Details:      
 
Domain Number - Region: 638-727
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000851
Family C1 set domains (antibody constant domain-like) 0.055
Further Details:      
 
Domain Number - Region: 804-893
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000937
Family C1 set domains (antibody constant domain-like) 0.062
Further Details:      
 
Domain Number - Region: 599-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00505
Family I set domains 0.041
Further Details:      
 
Domain Number - Region: 765-827
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00516
Family I set domains 0.041
Further Details:      
 
Domain Number - Region: 1097-1159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00527
Family I set domains 0.041
Further Details:      
 
Domain Number - Region: 1136-1226
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0167
Family C1 set domains (antibody constant domain-like) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116754978|ref|YP_844096.1|
Sequence length 2713
Comment hypothetical protein Mthe_1690 [Methanosaeta thermophila PT]
Sequence
MIYNRVGFVRTAITKIFLMLLIIVIVAANNVSALTLDSSSGVWTSVTGGSGITGVNTNEV
RWGTPAEKYKSGLRFDGVTSSQNIETGKDFCLGKLTHFNYPVYSGTAASGAKLKITLHFS
NPSITADFYYDLTIDETPNSGTCERCAYKPCETPCPDKVSWSNTLSSQSFFINGEEYIVQ
IAGFVNQCPGGTPVSDFITQEKKKNEAYLVGRVLLKRPAIGVVKTASLDGTCPGTDPVTA
GIGATVTYCYQVQNTGDVKLTDVSLTDDKYGTITLDKTTLEPGETAEGTSTHTVTPSDYP
LLKNIATATGKTPIGSTISAVDDCKVNVVCTPLTVSVSPTSGELNCNVNEVELEATVSGG
KPDYSYQWYKDNSPITGATGSSYTATGAGSYKVVVTDANGCTGTSDEVPVTSVGSPSVSV
GPTSGELNCNVNEVELEATVSGGKPDYSYQWYKDNSPITGATGSSYTATGAGSYKVVVTD
ANGCTGTSDEVPVTSVGSPSVSVGPTSGELNCNVNEVELEATVSGGKPDYSYQWYKDNSP
ITGATGSSYTATGAGSYKVVVTDANGCTGTSDEVPVTSVGSPSVSVGPTSGELNCNVNEV
ELEATVSGGKPDYSYQWYKGDSLINGATGSSYTAREAGIYKVEVTDANGCTGTSNEVTVI
RVGSPSVSVSPASGELNCNVNSIELTATVTGGEEPYSYQWYKDDSPITGATGSSYTATGA
GSYKVVVTDANGCTGTSDEVPVTSVGSPSVSVGPTSGELNCNVNEVELEATVSGGKPDYS
YQWYKGDSLINGATGSSYTAREAGIYKVEVTDANGCTGTSNEVTVIRVGSPSVSVSPASG
ELNCNVNSIELTATVTGGEEPYSYQWYKDDSPITGATGSSYTATGAGSYKVVVTDANGCT
GTSDEVPVTSVGSPSVSVGPTSGELNCNVNEVELEATVSGGKPDYSYQWYKDDSPITGAT
GSSYTATGAGSYKVVVTDANGCTGTSDEVPVTSVGSPSVSVGPTSGELNCNVNEVELEAT
VSGGKPDYSYQWYKDNSPITGATGSSYTATGAGSYKVVVTDANGCTGTSDEVPVTSVGSP
SVSVGPTSGELNCNVNEVELEATVSGGKPDYSYQWYKGDSLINGATGSSYTAREAGIYKV
EVTDANGCTGTSNEVTVIRVGSPSVSVSPASGELNCNVNSIELTATVTGGEEPYSYQWYK
DDSPITGATGSSYTATGAGSYKVVVTDANGCTAESSATITEVECITKIIVDKVTDPSGST
ESFEFTGSWSGGTTFSLTDGADPYDSGQLEPGEYTVTEIVPDGWDLSSIEIDGDTDGGST
STTSGSTATIDLDAGETIRVTFTNTLKTGGQGKLDVSGYKFNDLNGNGNWDTGEPGIEGW
TIYLSDGTTTISTTTGSDGSYSFTNLPAGKYTITEEERAGWSRTLPADLGSYEINFDGEE
DRSVADQNFGNVQTVQPQAKLAITSTPQDPCSNTPVVVTVSCENLQGDLCGSIASMTLYY
DSSSVEMTKGSNGRWTATVPGQSAGTTLSVYAVPKDSQGNFIESIGTTATVEITWVDCAI
DIEKTADRETVEPGDTITYTLTVKNTGSATINDATVVDTLPPGTLYKSADPEPSGVSGSV
VTWNLGALEAGASVVITLTATVESDVCTRQSFTPSDEQNQKRGLAPPVTGEERLTIMAAS
PVDQELIDSLYRNMTRLEAKLNYVRKYRDTFDKVNASLVISNVTLNGSVYKLMNYTNTTT
GDVLTEAYNSSGALAWSLLVRPQKYDSLRTEYVNGRVVSENYITREPWEGLLIEYDRPYP
GYTNLTVTYYPTGDTLVVVRDLYGNVISREYKKLPGVPPVPLELENCATVKGRIGEIEVS
DSSCAIVTLICPLPVQGKLTLDKRPSVEVASVGQTITYTYTITNGGEITISNIYVYDDRL
GRINADPITLDPGDTTEVTATYVVKATDESPIKNIATAKGEDPNGDPVVSDPAEAEVMIA
SEVLFNKTAEPKVVEPGDTITYTIRYQNRGGTLHDVRIVDYYPNEVYFISATPAPTSGNN
VWYIGDLASGESGEIVILVGVAQELGNMSFRMDQSVSGSGYVNVYNNLCTTPPRIVNRAE
MVYRLTQNGESTKVTTAAEVQLGPPATCAKIKEHGSGSYETDDLVRYERGNRTITWNKSL
SATHYPTSFSLPRNRSLNYTTLWVEKQKAKNYATDASFSEEYTYARDIKRDSSLQMDENG
SRLMIDTEFTGMGHVGILKAREGNLTKNALDNAVYESREDYVGSFRLYQKVDEYGEHLRS
ESEASGTGFASVDKRLGSAQRSYESGTGSYESSQLMDTLSSYMHKEISLEHAPANYTYSQ
GMGVNYTGKWYEGMWSKTDKSLISESFSSLNTLEKETYARGLNEMETEAEFSGKADFRVL
YQDLSGREGRTVDLVDQYIGDYKVNRKVSITGVSRYSYPHISVRKEGSVDLANSTYADYR
IIVENDGNVNLGPVYILDIFPPGTEYVGSSARPGELTSEYANWTLLHLGIGDTATISLTL
NITEEVSNLVNRVIVSGAHDDEWVTARNFSSIKVDWLECCPAELTATKTAAVHNDTVSYR
ISLSNRANYTMVAFVIDYIPSDMQLINYSLTPSQIRENRIEWAILDLRPGKRIDIDYNMR
ALRSGTFTNRARVEAYPIDGPGSVEADLAARAYVGVEIKEREREGWTVPKCMGLNCTESY
RDDWMSCSTCAPE
Download sequence
Identical sequences A0B9T2
349307.Mthe_1690 gi|116754978|ref|YP_844096.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]