SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116754990|ref|YP_844108.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116754990|ref|YP_844108.1|
Domain Number 1 Region: 6-228
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.41e-70
Family Pseudouridine synthase II TruB 0.000000119
Further Details:      
 
Domain Number 2 Region: 230-311
Classification Level Classification E-value
Superfamily PUA domain-like 7.18e-22
Family PUA domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116754990|ref|YP_844108.1|
Sequence length 321
Comment putative rRNA pseudouridine synthase [Methanosaeta thermophila PT]
Sequence
MRREGSTNSSYGCFPDRRPLQEHLRLGAINLDKPSGPTSHEVVAWVKRILGLEKAGHSGT
LDPRVTGILPVLTGDATRVVEFLLTAGKEYVCLMRTHEQVPRKKILEVCEEFSGEIYQRP
PLKSSVARNLRTRKIYYIDVLEIEGQRVLMKVGCEAGTYIRKLCYDMGLALGCGANMEEL
RRTKAGPFAEDETLVTLHNLKDAYEIWRESGDESALRRAVLPVERALRHLPGLVISDNAV
DAICHGAPLAAPGLLSLETDINKGDFVVIYTLKGEAVAIGRAKLSSDEMMVAKSGIVAST
ERVIMDPGVYPRRWKHSAEVV
Download sequence
Identical sequences A0B9U4
349307.Mthe_1702 gi|116754990|ref|YP_844108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]