SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM01G18060.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM01G18060.1
Domain Number 1 Region: 74-209
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.87e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.23e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM01G18060.1
Sequence length 216
Comment pep:novel chromosome:ALNU02000000:1:17345807:17348557:1 gene:OGLUM01G18060 transcript:OGLUM01G18060.1 description:""
Sequence
MAPAKVYGPAMSTNVMRILVCLEEVGAEYEVVPVDMSTGEHKRPPHISRNPFGQVPAFED
GDLTLFESRAISKYILRKHGSDLLRESNLSESAMVDVWLEVESSHFDGAMSPIIFQCFIV
PMFMGGATDMGVVNESLEKLKKALEVYEAQLSKSKYLAGDFISLADISHFPTVYYLLASA
HASVLEAYPRVKAWIDDVMQRPSVKKVTEALKMPSA
Download sequence
Identical sequences A0A0D3ENV6 A0A0D9Y8M4 I1NN50
ORGLA01G0129000.1 OGLUM01G18060.1 OBART01G15690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]