SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM03G37420.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM03G37420.1
Domain Number 1 Region: 19-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.5e-29
Family Thioltransferase 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM03G37420.1
Sequence length 134
Comment pep:novel chromosome:ALNU02000000:3:34631082:34632914:-1 gene:OGLUM03G37420 transcript:OGLUM03G37420.1 description:""
Sequence
MGSFFSTMFTPPPAADDGGDSRVVAVHSTATWDEQWGAHKSNPNKLIVIDFSANWCGPCR
FIEPAFKDMAGRFADAVFFKIDVDELSEVARQWKVEAMPTFVLIKGGKEVSRVVGAKKDE
LERKVNMFISSSSS
Download sequence
Identical sequences A0A0D9ZEJ1
OGLUM03G37420.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]