SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM06G18700.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM06G18700.1
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily At5g01610-like 6.54e-33
Family At5g01610-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM06G18700.1
Sequence length 164
Comment pep:novel chromosome:ALNU02000000:6:20528873:20529367:-1 gene:OGLUM06G18700 transcript:OGLUM06G18700.1 description:""
Sequence
MASQLVEEHRSGAEVHTGHELCERKARALLVELGLPDGLLPLPSLEEVGYNRAAGFVWLR
QTQAGGATHTFDTIGKQVWYAGEVTAFVEKGRMHGVAGVKSKELLIWVSISEIVLSPSGT
KLVFRTPAGLGRALPFTAFQLNPAPPEPEKKDAAADEADAAATN
Download sequence
Identical sequences A0A0E0AAL1
OGLUM06G18700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]