SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM01G36740.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM01G36740.1
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 4.18e-21
Family Rap30/74 interaction domains 0.0042
Further Details:      
 
Domain Number 2 Region: 185-251
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.01e-20
Family DNA-binding domain from rap30 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM01G36740.1
Sequence length 261
Comment pep:novel chromosome:ALNU02000000:1:35583509:35586777:-1 gene:OGLUM01G36740 transcript:OGLUM01G36740.1 description:""
Sequence
MAEEAKNLETARADRSVWLMKCPTVVSRAWQEAATAAASSSSSSDAAAGANSNSNANPNP
VVAKFKMEMAQTGNGNTPKSYSLNMFKDFVPMCVFSESNQGKLSCEGKVGHKFDMEPHSD
NLVNYGKLCRERTQKSMIKNRKLMVLANDNGMSMRPLPGLVGLMSSGPKQKEKKPLPVKP
SDMKRTRRDRRELENILFKLFERQPNWSLKNLMQETDQPEQFLKEILNDLCFYNKRGPNQ
GTHELKPEYKKSTEDADATAT
Download sequence
Identical sequences A0A0D3EUJ9 A0A0D9YFK3 A0A0E0FTS0 A0A0E0N328 A2WVJ1 B9ET91
OBART01G32590.1 ONIVA01G36860.1 OGLUM01G36740.1 OMERI01G28920.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]