SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM01G48760.4 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM01G48760.4
Domain Number 1 Region: 110-236
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.38e-25
Family alpha-D-mannose-specific plant lectins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM01G48760.4
Sequence length 443
Comment pep:novel chromosome:ALNU02000000:1:45391512:45398179:1 gene:OGLUM01G48760 transcript:OGLUM01G48760.4 description:""
Sequence
MRHAALLGVGFALCLLRAQAQPYDYPTAKPSTTWANTDAALRHHVAYTDGSVARAALLRL
NPARLGPSFAFGFFCTNHRAGAPCADFLLGVAVVYCNSGAGITAVTTGIPQVVWSANRAA
PVGDGATAELTADGDLVLRSPGGKVLWSAGAAGRGVSGMSINSDGNLVLFDGSNRTVWQS
FDHPTDTLVVGQSLKQGARLTANASFDNSSEGRIYLAVADDGLAAYVDAKPPQRYYVLGY
SKNAGAYAAYTNGSLAVLDRPGGQQLATVQLPAVAAGTVQYMRLEHDGHLRLYEWRSNGM
RWEAAGDVLHPYPGDCAYPTVCGAYGVCTDMQCSCPDAANFRAVDFRRPNRGCVPTSPPA
TCRSRRARHRLVSLRDTAYFNSHDTSMRTLERVGEAACKAACLGDCACMAAQFVYGFDPN
DGFCYLQSEVLSLETMQPEDLRS
Download sequence
Identical sequences A0A0D9YK84
OGLUM01G48760.2 OGLUM01G48760.3 OGLUM01G48760.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]