SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM02G19140.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM02G19140.1
Domain Number 1 Region: 89-172,240-261
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000756
Family alpha-D-mannose-specific plant lectins 0.0051
Further Details:      
 
Weak hits

Sequence:  OGLUM02G19140.1
Domain Number - Region: 385-420
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000706
Family Pan module (APPLE domain) 0.087
Further Details:      
 
Domain Number - Region: 238-300
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00884
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM02G19140.1
Sequence length 522
Comment pep:novel chromosome:ALNU02000000:2:20158094:20159662:1 gene:OGLUM02G19140 transcript:OGLUM02G19140.1 description:""
Sequence
MEAVRCIVVLCVAVAAALASLGGGAVDAAAAAAAAQEMRRGFSAAHDRSYSQFEQVLSDP
TGVFALGFLRVNSTMLDLAVVHLPSSFPLWRAIPDRPAQWSAPASLSFDGDLVLTDPAAN
KVLWSAGAATGAGGDRVVLLNTSNLQIQSGGGGGDGGSSPGIVWQSFDAPSETIVQGQNL
TSAAALYTSDRRFSMRMGTSYFGLYIEPPASSSGGGGVAAAMYWKHTALQAKAAIVDGGG
PTYARVEPDGYLAMYQKEGPPADVLSFDTFNHGVRALRRMTLEADGNLRAYYWDSTGSRW
VLDYTAITDPCGLPSTCGAYAVCVPPSGRCACLANATDGSGCAAASVGGGGGLCGRTGGE
VGGLYWEVRRQRVEPANKEFLPFEHSPSAADCEARCARNCSCWGAVYSNGTGYCYLMDYP
AQMMVAADERKVGYFKVRSLEEAAAASGGGRAAGVKAALLAVGVTVLVAAAAFGAYRVWK
RRYRTAVDARRQVVADDEGLSPGPYKNLGSFSSVELSSSFRR
Download sequence
Identical sequences A0A0D9YT30
OGLUM02G19140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]