SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM02G26060.5 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM02G26060.5
Domain Number 1 Region: 214-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.23e-22
Family UAS domain 0.00031
Further Details:      
 
Domain Number 2 Region: 433-486
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000031
Family UBX domain 0.04
Further Details:      
 
Weak hits

Sequence:  OGLUM02G26060.5
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily UBA-like 0.000194
Family UBA domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM02G26060.5
Sequence length 621
Comment pep:novel chromosome:ALNU02000000:2:26820588:26823919:1 gene:OGLUM02G26060 transcript:OGLUM02G26060.5 description:""
Sequence
MDNAAAVATFMEITSCGSQEAAVQHLASCRWDLDAALNRYFIFGGVLAAAPSPAPVADVA
PPAALDDGVRAPIPARSDTLYGDMYGGARRRDRDSRPAPSVWEDEPPAVTPSVAPVYIQM
PSANPAVAPVQIQMPSETAASVPAAPVPVHAPSQPPVVAIAVKKEQNEKDEEEDNGRDDD
DDGYSDSDYGMDTDDDDDRYDECIEKTPSPPPKSTQQQATTLAEMYRRPRELMHDADFHS
TKVHAARQDRWLLLNLQSAGEFASQMHNRDLWADQVIARVVRESFVFSLLENSYGDDDDE
ASKVCCFYKLHDQLPAVLVIDPITGQMLAKWSGVIQPETFLVDIEEYSKSKPSMRSKPYI
FQRKPMPVRSAPAASEQHHQEPAMADTAAPMDIHNVQEPDTAAPAPAPVVEHGVQQPATA
GAGAQQPADEQDDDDQPMEGEKMYRMRVRFPDGSVVTKEFGCKRRVAVLFNYCRSVLHDK
PQAFKIKRLLGVGGAFHELPQGDHSLHHACEEAQLNSSKRKSLSLAAGRWGNDVAIGATT
VGEDFELAAGSGNTARKCGRRRLGLELAGGSGATTRNNRYQRGPELGGGGGVNVISLDVA
YVFALEWNTVQRFVKLRTSDV
Download sequence
Identical sequences A0A0D9YVJ8
OGLUM02G26060.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]