SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM05G23560.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM05G23560.1
Domain Number 1 Region: 170-235
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.98e-21
Family DNA-binding domain from rap30 0.0041
Further Details:      
 
Domain Number 2 Region: 3-104
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 1.23e-17
Family Rap30/74 interaction domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OGLUM05G23560.1
Sequence length 243
Comment pep:novel chromosome:ALNU02000000:5:25827531:25830058:-1 gene:OGLUM05G23560 transcript:OGLUM05G23560.1 description:""
Sequence
MGEEAKYLETARAERSVWLMKCPPVVSHAWQGAVSSSDAAGSNPNPVVAKFKMEMAQTNT
GNTPKSYSLNMSKDFVPMCVFSESNQGKLSCEGKVEHKFDMKPHSDNLVNYGKLCRERTQ
KSMIKTRKVQVIEDHRMSLIPLPGMVGLIPSGSKEKKKQTPTKPSDAKRIRRDRRELENI
IFKLFERQPNWALKALVQETDQPEQFLKEILNDLCFYNKRGPNQGTHELKPEYKKSTGDT
DAS
Download sequence
Identical sequences A0A0D3G9M2 A0A0E0A1G3 A0A0E0HGS3 A0A0E0PPT1
OBART05G22270.1 OGLUM05G23560.1 ONIVA05G23240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]