SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM06G10440.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM06G10440.1
Domain Number 1 Region: 358-672
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-76
Family Protein kinases, catalytic subunit 0.0000796
Further Details:      
 
Domain Number 2 Region: 40-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.06e-69
Family Legume lectins 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM06G10440.1
Sequence length 751
Comment pep:novel chromosome:ALNU02000000:6:8355360:8357615:-1 gene:OGLUM06G10440 transcript:OGLUM06G10440.1 description:""
Sequence
MHPKPNSIVSISFLVFLLFHVLIFSHEAATAAAAVGGDSDHFRYDGFAGAPLDLDGMAVV
EPDGKLMLTNVTSQLKGHAFHPAPLSFVAPPPKPNATATASAAAVRSFSTTFVFAIAAEY
VTVSGNGLAFFVAPSKNLSAALPSQFLGLFNSENNGNASNRVFAVELDTIRNPEFGDING
NHVGVDVNGLASVASMPAGYYADDTGEFENLTLFSGAAMQVWVDYDGAAAAIDVTLAPVE
VPRPRRPLLSVAVDLSPVVAAADAAAYVGLSSSTGPHKTRHYVLGWSFAMDGPAPPLDYA
KLPKLPRASTKRRSMVLKVLVPVAAPLLALTVVVAVASVLLWRRRRRRHAEVREDWEVEF
GPHRFAYKDLVRATRGFDGKRLLGVGGFGRVYRGVLPASGTEVAVKVVSLSHDAEQGMRQ
FVAEVASVGRLRHRNVVPLLGYCRRRGELLLVYDYMPNGSLDRWLHGQSAPPLGWAQRVR
AIRGVAAGLLYLHEGWEQVVVHRDVKASNVLLDGEMDARLGDFGLARLYGRGAADPRTTR
VVGTLGYLAPELAHTRRVTPATDVFAFGSFVLEVACGRRPIERGGGAGDDDDDGDGEFVL
ADWVLDRWHKGDIAGAADARLRGDYDRKEAALVLKLGLLCTHPAPAARPPMRQVVQVLDG
DAPLPELSPTYRSFTTLAIVQNADGDDSGAVSCPSSSTVTTTSVDDGAFSVHSGDRMEKM
ETCSLILPPFHSHSSISDIHIDINECRHIYH
Download sequence
Identical sequences A0A0E0A7Q9
OGLUM06G10440.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]