SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM07G01310.4 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM07G01310.4
Domain Number 1 Region: 471-618
Classification Level Classification E-value
Superfamily At5g01610-like 1.57e-35
Family At5g01610-like 0.0012
Further Details:      
 
Domain Number 2 Region: 4-111
Classification Level Classification E-value
Superfamily At5g01610-like 6.28e-23
Family At5g01610-like 0.0025
Further Details:      
 
Domain Number 3 Region: 106-201
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000262
Family F-box domain 0.0071
Further Details:      
 
Domain Number 4 Region: 629-686
Classification Level Classification E-value
Superfamily At5g01610-like 0.000000000034
Family At5g01610-like 0.0036
Further Details:      
 
Domain Number 5 Region: 709-811
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000523
Family F-box domain 0.008
Further Details:      
 
Weak hits

Sequence:  OGLUM07G01310.4
Domain Number - Region: 807-940
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000111
Family Galactose oxidase, central domain 0.023
Further Details:      
 
Domain Number - Region: 194-381
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.000288
Family Galactose oxidase, central domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM07G01310.4
Sequence length 1065
Comment pep:novel chromosome:ALNU02000000:7:1122035:1139775:-1 gene:OGLUM07G01310 transcript:OGLUM07G01310.4 description:""
Sequence
MASQVESHRAGAEIVSGDGVSRKKSIELLEELGLPKGLLPLEDIEEFGYNKETGFMWLVQ
RKKKIEHTFKKIKQTGKLKKIAGVKTKELMLWLSVVEVYVAEASPEKILLRIPPDEPASL
VRASLVCKPWRRIITDPAFLRRYRAFHRTPPMLGFLHNVDGDKAISSAPRFVPTTTTASS
PFSPPAIGSPHWWWALDCRHGRVLINLFNPMELMVWDPIIGDQHRFPVPPHPHAYCTGAV
LCAARDCRHLDCHQGPFLVVFVGSGEHGYHYSWACLYSSETGEWSSKASIVFDSYVEMSP
SLLVEDMLFFICENGIRILGYDIGSHELWEIEPPLWDDYQGGTLMTAEDGGLGFATMETR
GLVLWSWYVDDDDGIADWEQLRVIKLEMLIPVDNPSVSLDLVGFIEGTQTIFVSSDVGVF
AIELKSGQVKKVGDSRPYYSVLPYMSFYTSGGGCRTQLEYRLYSDPSRPFRYASATYPMA
SQIESHRSGAEIVNGDAICRKKSIELLEELGLPKGLLPLEDIEEFGYNRGTGFMWLVQKK
KKIEHTFKKIKQTVSYANEVTAFTEKGKLKKITGVKTKELLLWLSVVEVYVTDALPDKVT
FKTGTGLSETFDAAAFALGDRPRLHSLPTAFVEKGKLKKITGVKTKELLLWLSVVEVYVA
DASPEKVTFKTGTGLSDTFDATAFALGDPSPPPPLPPKPSLRRRRASRVLPHGVCAGILL
RIPPDEPAHLVHASLVCKPWRRILTDPAFLRRYRAFHRTPPVLGFLHNVDGNKAISSVPR
FVPTTAASPFSPPAIDPPNWWWALDCRHGRVLSHLFNPMELMVWDPITGDQHRFPLPPHP
HAYCTGAVLCAASDRHHLDCHQGPFLVVFVGTGRHDHSWACVYSSETGEWSSHASIVLDS
YVEMLPSVLAENTLYFYCEYGTKILGYDIGKHELSEIDPPLGHDDGILIESEYGGLGFAT
VEACGLVLWSQYVCYDGIEEWEQSRIIELDMLIPNFFYSGGLVGFAEGTDIIFMLTDVDL
FAIELKSGQVKKVGESRPYYAVIPYMSFYTSDLARKRLAQPAGMQ
Download sequence
Identical sequences A0A0E0AFA4
OGLUM07G01310.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]