SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM08G24710.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM08G24710.1
Domain Number 1 Region: 71-146
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.0000000275
Family Plant cytotoxins 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM08G24710.1
Sequence length 148
Comment pep:novel chromosome:ALNU02000000:8:26560393:26564961:1 gene:OGLUM08G24710 transcript:OGLUM08G24710.1 description:""
Sequence
MAPKQASKQETKEPPESPVFELVLSDLQQSYQNVMEVEIPRELEALITKEAPITSQFSKV
AGKLYTPRKGGTFLVKMRPTETSTPEETVSLLFRWEDLYFEAFHARGKWFKLKDAKESLP
PRTQLPYPKKNGIYHLTRISTSYKDLGG
Download sequence
Identical sequences A0A0E0AYT1
OGLUM08G24710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]