SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM10G04850.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM10G04850.1
Domain Number 1 Region: 39-263
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.8e-35
Family Protein kinases, catalytic subunit 0.0032
Further Details:      
 
Domain Number 2 Region: 304-420
Classification Level Classification E-value
Superfamily PapD-like 2.22e-20
Family MSP-like 0.0078
Further Details:      
 
Domain Number 3 Region: 481-556
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000104
Family Ubiquitin-related 0.0021
Further Details:      
 
Domain Number 4 Region: 555-632
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000626
Family Ubiquitin-related 0.017
Further Details:      
 
Domain Number 5 Region: 632-706
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000338
Family Ubiquitin-related 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM10G04850.1
Sequence length 754
Comment pep:novel chromosome:ALNU02000000:10:6618156:6625480:-1 gene:OGLUM10G04850 transcript:OGLUM10G04850.1 description:""
Sequence
MGARVDEAMGLSGVCGRTRRKPVNIPDHCLRIVYLLYAKGKMAWRMKLQHLKDITDQFSP
GRELGKGGFGVVYKGILANGKPIAVKRLQVMPGIQDRQFNNEVHHLMGLKHQNIVQLIGY
CDERQEKVIYDEYQKKNICAEVQERLLCYEYMVNGSLDKGYMAPEYCHKGEISTKSDIYS
LGILILEIVTGEKNHQSSVDLSGQRFIHSVRNKWSRMSKITSRYPLLDTHSLQQVHSCFK
IGLTCVEIDPKRRPPARKIVNMLPWECKKAEAMASMLLPNVSNGRFTSSVVDKESNVTGL
PAHQVDSNMKEILSVNPLELWFPMKAQEEFSCSMLLKNKTHHYVAYKINAQKLNIYRTEP
CSGLISPQFTCNISVRMQAQQGVSPNMQLMDRILVQSVVVSDDQIDIAKDLSCKQKGKLV
LKGPDKIMSKIYVNIRKTEALDENKPICGTTEGIGNSHHDNKLSGLSIMKNSSCDDYAIN
GMRIYVKIPSIAKTIKLIVKNSNSVADVKVEIERKEGILLDNQMLMYAGRQLDDRQILSH
FGLSDDQILHVLICLFEKLRIFVNISNRRTVRLDVESWYTVADVKLMIEALLGFPACTQL
LMWTNPSVDIELMDTETLKDQNVKNNTVLLLHPNVQIFIKSWEGRTLTTLVSMFDTAEEI
WKKIKNRSQIKAEKYYLCYRGHVLPPGVSPDMYKIESNSTISIRLRNSYRKEEPGRITRG
TSSFTLQSSLMEWYQERKYARQAEATAEDTILHA
Download sequence
Identical sequences A0A0E0B8Q1
OGLUM10G04850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]