SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM10G10660.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM10G10660.1
Domain Number 1 Region: 285-347
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000399
Family U-box 0.019
Further Details:      
 
Domain Number 2 Region: 196-229
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000262
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OGLUM10G10660.1
Sequence length 875
Comment pep:novel chromosome:ALNU02000000:10:14452094:14460680:1 gene:OGLUM10G10660 transcript:OGLUM10G10660.1 description:""
Sequence
MAVYYKFKSARDYDSIPIEGQFISVANLKERIFESKHLGRGTDFDLMISNAQTDEEYADE
ATMIPKNTSVLIRRIPGRPRKPIVTEPEETKAMEGRVEETMPSGSAFLVDASMKYPEESE
WDDEFGNDLYVSDSVPSQLGSQAVDASENKVDEDSKIKALIDTSALDYSQIPDGYGGGRG
YGRGMGGRMMGGRGFGRGGLERRTPPAGYVCHRCKVPGHFIQHCPTNGDARFDMKRMKPP
TGIPKSMLMATPDGSYALPSGAGAVLKPNEAAFEKEIEGLPTTRSLGDLPPELRCPLCKE
VMKDAVLTSIRDYIINKSMCVCGATSILADDLLPNKTLRETISRILEAPPTSTVSAASKE
EPKRTPAPVEESPDVESHSEVKTTNVDMSSSDKKVPALPDVVEGTMESKILKEKTPEATP
VVKESQEKMPVVGEQVVKKKKKKKVRAPGNAEDWKPYQDFGAENFAGMPMGPAGGFNPYW
GGGMPLPMDYMGAPFPGPMPYMGYPPGPFDPFGGGVLPQDPFMPPGYMMPAVPRDLSELA
VNSMGMNMGPPVVSRDEFELRKPDNRRRREMERFNEREREHGHSRERERERERERERERE
RERERDRDRNRDRDRDQERDRDRERDRERESRREARESSGANNDSTTSMRPKARSRSSQP
ADRSAPPPPASPDRHSRRSPHRSSGSGKKRSSFDRYDDLPLPPPPPPASRHEAAEHAHAA
AAAAADARAKAKGSVFSRISFPGGDGNPSDAKRSRRSSSDKPPASSSSSSKKAAAAVAED
SDGRHHRRHHREAAAAAEERRRPAAGDYYGEEDEEEESEEEQHFKRRPSSSSRREREHQE
AQEEPRRSRERRGGGGGGDGNHHHNHGGGGGHKRR
Download sequence
Identical sequences A0A0E0BAT9
OGLUM10G10660.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]