SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM11G02840.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM11G02840.1
Domain Number 1 Region: 91-166,266-291
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000183
Family alpha-D-mannose-specific plant lectins 0.0093
Further Details:      
 
Weak hits

Sequence:  OGLUM11G02840.1
Domain Number - Region: 373-413
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00628
Family Pan module (APPLE domain) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM11G02840.1
Sequence length 507
Comment pep:novel chromosome:ALNU02000000:11:2023377:2024900:1 gene:OGLUM11G02840 transcript:OGLUM11G02840.1 description:""
Sequence
MRLDKGDPAIAGVVAALCVASAVMVAVVDGAKGDGRVTQLSNGFTARHSPDAPAPFEPVL
YAANGAFAFGFLRVGAASLDLAVVHLASSFPVWRATPARVWDWSRPATLTFDTGLVLAGG
NDAAGVLWQTLNAIGDTVVLLNSSNLVVRRFAETRPAWQSFDNPSDTLVLDQNLTVSSPP
LISGNRRFALRLAKTYMSLHMEFYGGRATPMYWQHTALEAQPENATQPPVYGCLDGRGFF
GLYLQGSGEKVDVLSFDTFVQNLTGAFRRMTLEDDGNLRAYYWTDDAKAWTADYKAITAP
CELPTSCGAYGLCVPGGGEAKCQCLTNSTATSPPCSAEETTDLCGDGDSDGGQVFDEVRL
KRVSVAYKERLPFEANATAEQCEQACAGNCSCWGAVHSGASGYCYLLDFPVETMVYEADD
RKVGYFKVRRPPRSSTRRGMSPGAKAVTAALSLILASLAVAGAYVGHRLWQRRQRRRRAG
GMEQELTSSGPYKDLKSMGSSNSSFKS
Download sequence
Identical sequences A0A0E0BFC3
OGLUM11G02840.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]