SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM12G02410.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM12G02410.1
Domain Number 1 Region: 71-179
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000017
Family alpha-D-mannose-specific plant lectins 0.0091
Further Details:      
 
Weak hits

Sequence:  OGLUM12G02410.1
Domain Number - Region: 313-363
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000345
Family Hairpin loop containing domain 0.065
Further Details:      
 
Domain Number - Region: 419-495
Classification Level Classification E-value
Superfamily Bacteriochlorophyll A protein 0.0144
Family Bacteriochlorophyll A protein 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OGLUM12G02410.1
Sequence length 587
Comment pep:novel chromosome:ALNU02000000:12:1794174:1799370:1 gene:OGLUM12G02410 transcript:OGLUM12G02410.1 description:""
Sequence
MDAPFLTTSLAVLATLFLLAVPLSAATHDILPLKSSLFVEEYETNILQSSDGTFSCGFYN
ITNAYNITSAFTLSIWYSNSADKAIVWSANRGRPVHSRRSEITLRKDGNIVLTDYDGTVV
WQTDDTLLPTQRILATTKLVSTTGLQVPGHYSFRFSDQSILSLIYDDTNVSGVYWPDPDY
QYYENNRNLYNSTRIGSLDDYGEFFSSDLAKHQARVASDRSLGIKRRLTLDYDGNLRLYS
LNNSDGTWTISWIAQPQTCMTHGLCGPYGICHYSPTPRCSCPPGYKMRNPGNWTQGCKPI
VEIACDGKQNVTFLQLRNTDFWGSDQQRIEKVPWEVCWNTCISDCTCKGFQYQEGNGTCY
PKSFLFNGRTFPTPFVRTMYIKLPSSLDVSKKPIPQSSIHDYTPSGLDCDHVNTITTEAV
RNMNKIGGEEPKWFYFYGFIGVFFIVENDGGVKLKCFNLECSFVQTSKKHAIGAKYDKFS
TDDGPAVWWVSLMDEPIGYFHESAFTAPFIKSFHNEMGGHVLDRRPGGRHTLTPMGSGMY
PSDGLQNAACIHAYLAIAYTGADQVDDPVNTIVTHPKCYDIRQGRWP
Download sequence
Identical sequences A0A0E0BNG7
OGLUM12G02410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]