SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116753506|ref|YP_842624.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116753506|ref|YP_842624.1|
Domain Number 1 Region: 214-322
Classification Level Classification E-value
Superfamily SIS domain 9.3e-16
Family mono-SIS domain 0.0021
Further Details:      
 
Domain Number 2 Region: 35-216
Classification Level Classification E-value
Superfamily SIS domain 0.000000089
Family mono-SIS domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116753506|ref|YP_842624.1|
Sequence length 397
Comment sugar phosphate isomerase [Methanosaeta thermophila PT]
Sequence
MSGLFEIFREATLLQCGFLEKLLRLDMSEVASFSESLASFLSDTERNKFVYGLAAGRSAL
SLYSFLQLLQNHFDNIFPCTLEDPVQRHFNPRKMNLGIAVSGSGETPSVNKYIEDVMGQG
GEIKLITANRNGTAYRLVEDYKNGTILVIEGRTKYSTDKERRSRLSPLGTEFELEVLAFL
NALFKDIQARLDGHHDDRCPEYCSTIQDFEENGRLIADMDQEHLERWFGRLFPRSGRYVI
GGVGRSGLVARAFEMRFTHLNKISYWERDFNTPSFQIGDVYIPITGGGNTYEALEGARNA
FRNGADVMPITANSGSNLMALVREKGRLDDVVFIPVKKDYEGLFKGNRSTTSWLVSEFTK
YRYPIFEINTSIFTNSVVAVGAEFLGIVEAGMRRLHV
Download sequence
Identical sequences A0B5L0
349307.Mthe_0185 gi|116753506|ref|YP_842624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]