SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116753883|ref|YP_843001.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116753883|ref|YP_843001.1|
Domain Number 1 Region: 6-255
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 2.79e-116
Family Methyl-coenzyme M reductase gamma chain 0.0000000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116753883|ref|YP_843001.1|
Sequence length 255
Comment methyl-coenzyme M reductase, gamma subunit [Methanosaeta thermophila PT]
Sequence
MAYTPQYYPGNTSVGANRRKHMSGNLEKLRDIPEADVVAIMGHRAPGADYPSTHPPLKEM
GEPDCPIRQLVEPTPGAAAGDRVRYSQFADSMYFAPSIPYWRSYWAAINCRGADPGTLSG
RQIIEARERDIEAYTKKLMDSEMTDVARCSMRGCTVHGHSLRLEENGLMFDMLARTELGA
DGNVYYVKDQVGIPLDKKINVGKPMSEDELKKRTTIFRYDNVSFGGKVGARKFDEALEAL
HHMWEYRTKWGFRPE
Download sequence
Identical sequences A0B6N7
gi|116753883|ref|YP_843001.1| 349307.Mthe_0570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]