SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|118444501|ref|YP_878195.1| from Clostridium novyi NT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|118444501|ref|YP_878195.1|
Domain Number 1 Region: 302-451
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-32
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 192-288
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.41e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|118444501|ref|YP_878195.1|
Sequence length 504
Comment phosphodiesterase [Clostridium novyi NT]
Sequence
MIITILIAIFVIIYVRKNISQAKIAEAEAKSKKIIIDSEKNAEAIKKEAILEAKEEVHRI
RNDFEKESRERRNEIQRLERRIIQREELLDKKSEAIENKEEVLNKKQQDINEKAASIDEL
YDKQREELEKLSNLSSDEARELLLEETKKEIRHDLAVMIKEMENKAKEEADKKAKEIIST
AIQRCAADHVAESTVHVVSLPNDEMKGRIIGREGRNIRALETLTGVDLIIDDTPEAVILS
GFDPIRRQVARIALEKLIIDGRIHPARIEEMVEKAKQEVENDIKEEGEQATFETGVHGLH
QELVKLLGRLKYRTSYGQNVLKHSMEVAYLAGLMASELGMDPTLAKRSGLLHDIGKAVDH
EIEGPHALIGSEMAKKYHESSVVVNAIAAHHGDVEYESIEAILVQAADAISAARPGARRE
TLEAYIKRLEKLEEIANSYEGVEKSYAIQAGREVRIMVKPEDIDDYGCIEMSKNIVKRIE
SELEYPGQIKVNIIREVRAVEYAK
Download sequence
Identical sequences A0Q0P3
386415.NT01CX_2122 gi|118444501|ref|YP_878195.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]