SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|565990334|ref|YP_008909886.1| from Paenibacillus polymyxa CR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|565990334|ref|YP_008909886.1|
Domain Number 1 Region: 170-398
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.25e-29
Family Type II chitinase 0.0063
Further Details:      
 
Domain Number 2 Region: 55-142
Classification Level Classification E-value
Superfamily Copper amine oxidase, domain N 3.47e-22
Family Copper amine oxidase, domain N 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|565990334|ref|YP_008909886.1|
Sequence length 415
Comment glycosyl hydrolase [Paenibacillus polymyxa CR1]
Sequence
MKIVNKALLSSAIFLSTAAGIYSPLAQAETGKISIMLDGYPLPFPVQPAMMNGTTMVPFR
AISEALGITVKWDQASQSITATKAQGSATKQVVLKMGSRNATVDGQTVQLTAAPQTVHGS
TMIPLGFFGQQFGATVNWNQGTRTVSITSPREAMYTVGFYALSSFDQKSKIPDFNAVAFG
WSRIDTNGQFTTNGKEYKWPQAAGTVTPESIVQEADSQGTSPYLMVYSGDGNHELTKVLE
NAQLQEQTISQIVSTATDKQFKGITLDLEGLGWSGDKAKARSDYNAFIQKLSAKAHQAGL
KLTVVLHPLNSSYSGYDYKTLGNLADDLIIMAYDYGQKATPEPLDKVDEAIQLALKETSR
DKLILGISMGSEKDSTVNAKIGLAKRYDLKGIAIWRLGIIGETAWAQMNEAIEFK
Download sequence
Identical sequences A0A1C3CEU9
gi|565990334|ref|YP_008909886.1| WP_023986691.1.12882 WP_023986691.1.1883 WP_023986691.1.21208 WP_023986691.1.44575 WP_023986691.1.6981 WP_023986691.1.77953 WP_023986691.1.78517 WP_023986691.1.82066 WP_023986691.1.94972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]