SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134097332|ref|YP_001102993.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134097332|ref|YP_001102993.1|
Domain Number 1 Region: 1-415
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 3.14e-97
Family Gtf glycosyltransferase 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|134097332|ref|YP_001102993.1|
Sequence length 421
Comment glycosyl transferase [Saccharopolyspora erythraea NRRL 2338]
Sequence
MRVVFSSMASKSHLFGLVPLAWAFRAAGHEVRVVASPALTEDITAAGLTAVPVGTDVDLV
DFMTHAGHDIIDYVRSLDFSERDPATLTWEHLLGMQTVLTPTFYALMSPDTLIEGMVSFC
RKWRPDLVIWEPLTFAAPIAAAVTGTPHARLLWGPDITTRARQNFLGLLPDQPEEHREDP
LAEWLTWTLEKYGGPAFDEEVVVGQWTIDPAPAAIRLDTGLKTVGMRYVDYNGPSVVPEW
LHDEPERRRVCLTLGISSRENSIGQVSIEELLGAVGDVDAEIIATFDAQQLEGVANIPDN
VRTVGFVPMHALLPTCAATVHHGGPGSWHTAAIHGVPQVILPDGWDTGVRAQRTQEFGAG
IALPVPELTPDQLRESVKRVLDDPAHRAGAARMRDDMLAEPSPAEVVGICEELAAGRREP
R
Download sequence
Identical sequences A0A2A9J4E4 A4F7P3
405948.SACE_0726 WP_009950402.1.17192 WP_009950402.1.58781 WP_009950402.1.76288 gi|134097332|ref|YP_001102993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]