SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134097392|ref|YP_001103053.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134097392|ref|YP_001103053.1|
Domain Number 1 Region: 4-74
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000311
Family Tetracyclin repressor-like, N-terminal domain 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|134097392|ref|YP_001103053.1|
Domain Number - Region: 76-174
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.001
Family Tetracyclin repressor-like, C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|134097392|ref|YP_001103053.1|
Sequence length 182
Comment TetR family transcriptional regulator [Saccharopolyspora erythraea NRRL 2338]
Sequence
MAARDTRDRILDALQRILVRKGTAAVTLESVAAEAGVSKGGLLYHFRSKQAMLQGLTLRL
SEDAEAEFAQAERAGADVVRYFLETSLPASDEEMALYWSVIAALRSAEGLSEDGTEVLAR
VFGRWSELLTDHIGDPVLAETVRLVGDGLYLSALSGLPNPDPELLRRVFDRLLEQVAEAR
GE
Download sequence
Identical sequences A4F7V3
405948.SACE_0786 gi|134097392|ref|YP_001103053.1| WP_009944289.1.17192 WP_009944289.1.58781 WP_009944289.1.76288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]