SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|134099762|ref|YP_001105423.1| from Saccharopolyspora erythraea NRRL 2338

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|134099762|ref|YP_001105423.1|
Domain Number 1 Region: 103-261
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 2.22e-24
Family Tetracyclin repressor-like, C-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 32-94
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000041
Family Tetracyclin repressor-like, N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|134099762|ref|YP_001105423.1|
Sequence length 268
Comment TetR family transcriptional regulator [Saccharopolyspora erythraea NRRL 2338]
Sequence
MVVYAGQGDPRRSMSLLWRDAGTAERTGPGPKPGLSVDLVVDTAIELADAEGMPALSMRA
VGERLGRTAMALYTYVPGKNELIDLMYDRALAELPTDYPADQGWRSAVTAWADDLWRFYL
RHPWVLQVSQARPVLGPNEYGVLEALVRVLDGTGLAAGELRRVVGTLFHVVRGAAQTIAE
SRHAAAATGVSDEEWWFARAGVLREVAPDFAERFPMVLRLEADQAAGWEDDGSPYLEREA
KRTFEAGLAVVLDGIEAAMARTQRDRAR
Download sequence
Identical sequences A4FEM3
405948.SACE_3223 WP_009945595.1.17192 WP_009945595.1.58781 WP_009945595.1.76288 gi|134099762|ref|YP_001105423.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]